Protein Info for AMB_RS01560 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF02771: Acyl-CoA_dh_N" amino acids 169 to 278 (110 residues), 113.7 bits, see alignment E=1.2e-36 PF02770: Acyl-CoA_dh_M" amino acids 284 to 384 (101 residues), 58.8 bits, see alignment E=9.9e-20 PF00441: Acyl-CoA_dh_1" amino acids 399 to 548 (150 residues), 142.6 bits, see alignment E=2.2e-45 PF08028: Acyl-CoA_dh_2" amino acids 416 to 534 (119 residues), 56.1 bits, see alignment E=9.9e-19

Best Hits

KEGG orthology group: K14448, (2S)-methylsuccinyl-CoA dehydrogenase (inferred from 100% identity to mag:amb0308)

Predicted SEED Role

"Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAL3 at UniProt or InterPro

Protein Sequence (553 amino acids)

>AMB_RS01560 acyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MTAILLPDLIPTCESAIAVVDTLRLAAKANVTAMVSKDGKVNGALFDANQTAAHGYAWLA
TYVAALQQMLGWAKRLEAEGKLGELETLMLQAAFGEYCAQIYGGIPMSQGEIVRLADLGL
DSPTIHKLSCKEINVLRRQGCTAAVRSRIAELIKDGHHFGEPGLEDETLILIRDQFRSFA
ENEVIPHAHEWHLKDELIPIEVVNHVAEMGVFGLTLPEEYGGLGLGKMSMCVVTEELSRG
YIGVGSLGTRSEIAGELIRLGGTEEQKQEWLPKIASGEILPTAVFTEPNTGSDLGSLRTR
AVKQGDEYVVTGNKTWITHAARTDVMTLLVRTNPDTKDWKGLSMMIAPKPRGTEANPFPA
EGMTGGEIKVLGYRGMKEYELGFDGFKVPAANLLGGVEGQGFKQLMETFESARIQTAARA
VGVAQCAMEVGLKYANERVQFGKPIYEFPRVGGKIAWMAVETMIARQLTYFSAREKDEGH
RCDIEAGMAKLLAARVAWANADNALQVHGGNGYAEEYPISRILCDARILNIFEGAAEIQA
QVIARGLLSGARD