Protein Info for AMB_RS01455 in Magnetospirillum magneticum AMB-1

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 868 TIGR01070: DNA mismatch repair protein MutS" amino acids 1 to 865 (865 residues), 863.8 bits, see alignment E=7.9e-264 PF01624: MutS_I" amino acids 1 to 115 (115 residues), 131 bits, see alignment E=5.7e-42 PF05188: MutS_II" amino acids 124 to 251 (128 residues), 72.9 bits, see alignment E=8.7e-24 PF05192: MutS_III" amino acids 268 to 560 (293 residues), 154.7 bits, see alignment E=9.7e-49 PF05190: MutS_IV" amino acids 430 to 520 (91 residues), 70.6 bits, see alignment E=2.9e-23 PF00488: MutS_V" amino acids 616 to 801 (186 residues), 275.3 bits, see alignment E=7.4e-86

Best Hits

Swiss-Prot: 100% identical to MUTS_MAGSA: DNA mismatch repair protein MutS (mutS) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to mag:amb0287)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAN4 at UniProt or InterPro

Protein Sequence (868 amino acids)

>AMB_RS01455 DNA mismatch repair protein MutS (Magnetospirillum magneticum AMB-1)
MMAQYLAIKRAHPDCLLFYRMGDFYELFFDDAVKASAALDIALTKRGKHAGEDIAMCGVP
VRAYEAYLAKLVRSGFKVAIGEQMEDPAEAKKRGSKSVVARDVVRVITAGTLTEDTLLDA
RSHNYLAAVAEAQGTLGLAWVDVSTGDFAMQAIAPKTLAAALARLSPGELLVSDRLLGAA
DFFDVWADWKNVLSPLPTARFDSENSRRRLEALYGVGALDGFGAFSRAELAAGGALVDYV
ELTQKGKLPRLSLPKRLAEGAVMEIDAATRRNLELAETLSGERRGSLLATIDRTVTGAGA
RLLAAQLAAPLTDPHAIEWRLDMVGFFVEHESVRAQLRETLKRCPDVERALSRLSLGRGG
PRDLANVRDALAEIPALRMLVTQSHLDTPPGINQCARELGEHSALVDRLQRALAPDLPLN
ARDGGFIAQGYHEGLDELKGLKTESNGLMMRLEKRYQDETGIASLKIRHNNIIGHHIEVP
SKQADRLGEGYIHRQTMANAARYTTTELIELAGKITGAADRALALEMELLADLIGEVTAR
AAEIALAAAALAGLDCASALGEMASSARWSRPRVDDSTAFDIRGARHPVVEAALEAARSG
PFVANDCDLADSQRLWLVTGPNMAGKSTFLRQNAVIAILAQMGSFVPAESVHMGVVDRLF
SRVGAADDLARGRSTFMVEMVETAAILNQAGPRALVILDEIGRGTATFDGLSIAWAVVEH
LHEVNRCRALFATHYHELTRLTSRLAALSCHMMRVKEWQGDVVFLHEVGAGAADRSYGIH
VARLAGLPPAVVGRAEEVLGILEKSDQASGMARLADDLPLFAALAKPRPAATALPQASPL
EEALKAVNPDDLTARQALDLVYELKRLL