Protein Info for AMB_RS01405 in Magnetospirillum magneticum AMB-1

Annotation: cobalt ECF transporter T component CbiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details PF02361: CbiQ" amino acids 13 to 210 (198 residues), 157.6 bits, see alignment E=1.8e-50 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 18 to 206 (189 residues), 136.2 bits, see alignment E=6.2e-44

Best Hits

Swiss-Prot: 47% identical to CBIQ_RHOCB: Cobalt transport protein CbiQ (cbiQ) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to mag:amb0277)

Predicted SEED Role

"Transmembrane component CbiQ of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAP4 at UniProt or InterPro

Protein Sequence (244 amino acids)

>AMB_RS01405 cobalt ECF transporter T component CbiQ (Magnetospirillum magneticum AMB-1)
MSLTIDRLSQAGRWRQRAPSEKAVLALGLLALALVLPPWPGGALVLGAAWGLALGGARLP
PGDWLRLNLVPLGFVLTGAATLAVDWDAQGLHLAADQGRRAAEVVLRASAAVSALLLLAA
TTPAPDLVRGLRRLGLPPEIAEIMLLTWHFLFLLQDQATAIRTAQEARLGWFGPRRQVRS
LGLLIAQLLPRAMERARRLEVGLAARGFDGSLPMISTANPASVPVVAVILGGEALLAGVS
LWLA