Protein Info for AMB_RS01395 in Magnetospirillum magneticum AMB-1

Annotation: energy-coupling factor ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details amino acids 28 to 28 (1 residues), see Phobius details transmembrane" amino acids 22 to 25 (4 residues), see Phobius details amino acids 27 to 27 (1 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details TIGR00123: cobalamin biosynthesis protein CbiM" amino acids 1 to 207 (207 residues), 277.1 bits, see alignment E=5.7e-87 PF01891: CbiM" amino acids 2 to 207 (206 residues), 170.6 bits, see alignment E=2.1e-54

Best Hits

Swiss-Prot: 68% identical to CBIM_RHOCB: Cobalt transport protein CbiM (cbiM) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to mag:amb0275)

Predicted SEED Role

"Substrate-specific component CbiM of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAP6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>AMB_RS01395 energy-coupling factor ABC transporter permease (Magnetospirillum magneticum AMB-1)
MHIMEGFLPAGHALAWTCVAAPFVALGARSLKRIVAERPEARLNIAASAGFTFVLSALKL
PSVTGSCSHPTGTALGAMQFGPGIMAVIGTIVLLFQGLLLAHGGLSTLGANVFSMAIAGP
WVAYGVWRLAGRLGAPAAVTIFLSAFLGDLATYVVTSFQLALAFPDAQSGFGGAFAKFAG
IFAITQLPLAVAEGLVTVVVMNALQSRMTPVEGAKA