Protein Info for AMB_RS01395 in Magnetospirillum magneticum AMB-1
Annotation: energy-coupling factor ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to CBIM_RHOCB: Cobalt transport protein CbiM (cbiM) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to mag:amb0275)Predicted SEED Role
"Substrate-specific component CbiM of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2WAP6 at UniProt or InterPro
Protein Sequence (216 amino acids)
>AMB_RS01395 energy-coupling factor ABC transporter permease (Magnetospirillum magneticum AMB-1) MHIMEGFLPAGHALAWTCVAAPFVALGARSLKRIVAERPEARLNIAASAGFTFVLSALKL PSVTGSCSHPTGTALGAMQFGPGIMAVIGTIVLLFQGLLLAHGGLSTLGANVFSMAIAGP WVAYGVWRLAGRLGAPAAVTIFLSAFLGDLATYVVTSFQLALAFPDAQSGFGGAFAKFAG IFAITQLPLAVAEGLVTVVVMNALQSRMTPVEGAKA