Protein Info for AMB_RS01310 in Magnetospirillum magneticum AMB-1

Annotation: protocatechuate 3,4-dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF02900: LigB" amino acids 8 to 268 (261 residues), 199 bits, see alignment E=4.1e-63

Best Hits

Swiss-Prot: 44% identical to PCYB_SPHSK: Protocatechuate 4,5-dioxygenase beta chain (ligB) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K04101, protocatechuate 4,5-dioxygenase, beta chain [EC: 1.13.11.8] (inferred from 100% identity to mag:amb0258)

MetaCyc: 44% identical to protocatechuate 4,5-dioxygenase beta chain (Sphingomonas sp. SYK6)
Protocatechuate 4,5-dioxygenase. [EC: 1.13.11.8]; 1.13.11.- [EC: 1.13.11.8]; RXN-10889 [EC: 1.13.11.8]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.8

Use Curated BLAST to search for 1.13.11.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAR3 at UniProt or InterPro

Protein Sequence (278 amino acids)

>AMB_RS01310 protocatechuate 3,4-dioxygenase subunit beta (Magnetospirillum magneticum AMB-1)
MAKIVGGINVTHVPYIGRAIAGNLQQDAYWKPFFDGFPPVHAWLDKVKPDVAVVVYNDHG
LNFFLDKMPTFSIGAAAEYSNADEGWGIPTVAPFKGDQDLSWHLIDSLIEAEFDLTTCQE
MLVDHAFTLPLELLWPTRNAALRTVPICQNTVQFPLPSAKRCLAFGRAINKAIESWDSDA
RVVVLGTGGLSHQLEGTRAGFINKKFDLEFMDKLVSDPDWVTQYSNEDLVELTGTQGIEL
LNWLTCRGALGGKVKAVHTNYHIPISNTAAGLLAMETV