Protein Info for AMB_RS01270 in Magnetospirillum magneticum AMB-1

Annotation: 4-oxalomesaconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to LIGU_NOVK1: (4E)-oxalomesaconate Delta-isomerase (ligU) from Novosphingobium sp. (strain KA1)

KEGG orthology group: K09788, hypothetical protein (inferred from 100% identity to mag:amb0250)

MetaCyc: 57% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FldA protein"

MetaCyc Pathways

protocatechuate degradation I (meta-cleavage pathway) (8/8 steps found)
methylgallate degradation (6/6 steps found)
superpathway of vanillin and vanillate degradation (8/10 steps found)
gallate degradation II (4/5 steps found)
gallate degradation I (3/4 steps found)
syringate degradation (8/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAS1 at UniProt or InterPro

Protein Sequence (363 amino acids)

>AMB_RS01270 4-oxalomesaconate tautomerase (Magnetospirillum magneticum AMB-1)
MQTPIPCLFMRGGTSRGPFFLESDLPADMALRDKVLLAVMGSPHARQIDGLGGGHPLTSK
VGIVRPSTTPGVDLDFLFAQLQPDRETVDTTPNCGNMLAAVVPFALERGIVRPQGDTTTL
RVLTLNTDMQCDITVRTPGGRMEYQGEARIDGVPGTASPIAINFLDTAGSVCTGLLPTGR
TRDVIDGLEVTCIDNGMPMVLFRAADLGRTGAESVETLNADTELKARIETLRLKAGHLMG
LGDVGPKNYPKMCLVAPPSAGGALGTRCFIPHVCHDAIGVLAAVTVATACVLEGSVTEGL
ANVPGGAVKTIAVEHPTGEFSVELELDLADPQKVVRAALLRTARLLMKGEVMIPAAIWEG
KSA