Protein Info for AMB_RS01245 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 191 to 211 (21 residues), see Phobius details PF00672: HAMP" amino acids 211 to 255 (45 residues), 28.5 bits, see alignment 1.6e-10 PF00015: MCPsignal" amino acids 381 to 521 (141 residues), 95.1 bits, see alignment E=4.4e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0245)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAS6 at UniProt or InterPro

Protein Sequence (561 amino acids)

>AMB_RS01245 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MPSVATIRGKLTALAVTVAVVLGGLSLGWGVVLSELKVNGPVYGRIVQAKDLVADILPPP
EYIIESYLVASQALAAEPSKLAPLKEAMIRLRRDYDDRHQYWQGQDLEASVRDGLLVESY
KPAVQFFDHAFSTYFPALEKGDREAARASFAVLGGLYATHRAAIDTLVTRSDALSKAVEA
QAAASESSYKLLVIVLTLASALAALALVIGMSRAIVAPMARLGEAVGRLGGGALDAGVPE
TERVDEIGPLARALDGWRQGLIAAEARRRDEAEEQSRLQARQRRVEAATRRFDEAIITML
ARIRDSAENLHAASNSLSANAEQTHAQGAAVSAATEQSAASVESVASAGNQLSSSIEEIS
SQVRQSSAIVAAASHEAEAANGRIAGLTEAVERIGQVLSLINDIASQTNLLALNATIESA
RAGEAGKGFAVVAHEVKNLAGQTSRATEDIARQIAAVRDEAGTAVAALAGIAQTIARINE
MSASIAGAVEQQGAAASEISRNVEQAAAGSREVVHNITGVVGAAGETGAMARNVFAAANQ
LLGQSTELEREVAAFLREMAA