Protein Info for AMB_RS01230 in Magnetospirillum magneticum AMB-1

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00460: methionyl-tRNA formyltransferase" amino acids 1 to 297 (297 residues), 302.9 bits, see alignment E=1.2e-94 PF00551: Formyl_trans_N" amino acids 1 to 179 (179 residues), 156.4 bits, see alignment E=6.8e-50 PF02911: Formyl_trans_C" amino acids 204 to 296 (93 residues), 90.1 bits, see alignment E=8.7e-30

Best Hits

Swiss-Prot: 100% identical to FMT_MAGSA: Methionyl-tRNA formyltransferase (fmt) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to mag:amb0242)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAS9 at UniProt or InterPro

Protein Sequence (305 amino acids)

>AMB_RS01230 methionyl-tRNA formyltransferase (Magnetospirillum magneticum AMB-1)
MKLVFMGTPDFSVPILDSLIEAGHQVICVYSQPPRPAGRGHKEQLTPVHAFAHERGIPVR
TPKSLKPAEAQAEFAALEADVAVVAAYGLILPQAVLDAPRLGCLNVHASLLPRWRGAAPI
QRAILAGDAETGITIMQMDAGLDTGAMLSRESILLAPDTTAPWLHDMLAAMGARMIVETL
ARLEDDEPPAATPQPAEGVTYAHKLAKEEGLLDWRRNAVELDRKVRALNPWPGVWFEMAG
ERIKVLEAAVTPGSGAPGTVLDDQLTIACGKFALRPLKVQRAGKAPMTASEMLRGHAIPK
GTVLG