Protein Info for AMB_RS01180 in Magnetospirillum magneticum AMB-1

Annotation: dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01872: RibD_C
  • amino acids 9 to 166 (158 residues), 57.5 bits, E=1.7e-19
• PF00186: DHFR_1
  • amino acids 46 to 121 (76 residues), 27.5 bits, E=2.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0232)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (2/3 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (6/10 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

See Q2WAT9 at UniProt or InterPro

Protein Sequence (173 amino acids)

>AMB_RS01180 dihydrofolate reductase (Magnetospirillum magneticum AMB-1)
MAAGFRAYIAASLDGYIADSDGSIAWLKPFDAIDYGFDEFMEHIGTVVMGRTTYEHLHAM
GHWPHGDKRCIVVTSRSMETAPDNVEPWLGDLAQLVAELKASPDGDIWVAGGAKALRAFL
DLGAIGHFDLFIMPVLLGKGRPLFLPSDRGDRMTLLGAKTYINGVVRLSYVVG