Protein Info for AMB_RS01100 in Magnetospirillum magneticum AMB-1

Annotation: potassium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 387 (372 residues), 160.9 bits, see alignment E=4.3e-51 PF03471: CorC_HlyC" amino acids 491 to 563 (73 residues), 28.8 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to mag:amb0216)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAV5 at UniProt or InterPro

Protein Sequence (597 amino acids)

>AMB_RS01100 potassium/proton antiporter (Magnetospirillum magneticum AMB-1)
MIESMNFSILIVSGLVALSIFSSLLSFRIGAPLLLVFLCVGLVAGENGLGRIKFDDVRAA
YMIGSIALAIILFDSGFHTSLKAFRAALWPAMAMATGGVVVTTTVVAVPVHYLMGFDWLE
SALMGAILSSTDAAAVFFLLRVGGIHVRDRVRSTLEVESGSNDPMAIFLTLALIGLLVAK
GPISPVAIGMDFITKFGIGAPAGMFGGGLIVLAVNKMGFERGLQPLAALSLAMVLFAATE
ELHGSGFLAVYIAGLVAGNARINAPETMRRFQDGLTWLAQIVMFLTLGLLATPAEFPAFA
WQSLGVAGVLIFVARPLAAWICLLPYGFNRNETAFVAWVGLRGSVSVLLSIVPMVVGLPH
GRDYFILAFLVVMISLGLQGWTIGAVARFLGQIVPKRIGPVERMELEIPGARHELVSYGI
VADSLVARGHRLPRWAEPSLVVRDKKSYSTHAAKGLKPGDTVFLFARPERVPHLDRLFAS
AAPAAEADSRFFGDFALEPGAHMKDLALLYGLPVAAADHDMSVADWLIRELGHEPGIGDR
AGLGEVELIVRAMDWDDRISEIGLAVEPTRIDAPRLPVFQSRTELKAMLKRWMRKRA