Protein Info for AMB_RS01095 in Magnetospirillum magneticum AMB-1

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 8 to 278 (271 residues), 260.1 bits, E=1.1e-81
• PF01678: DAP_epimerase
  • amino acids 8 to 125 (118 residues), 80.9 bits, E=4e-27
  • amino acids 155 to 270 (116 residues), 103.9 bits, E=3e-34

Best Hits

Swiss-Prot: 65% identical to DAPF_RHOCS: Diaminopimelate epimerase (dapF) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to mag:amb0215)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

See Q2WAV6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>AMB_RS01095 diaminopimelate epimerase (Magnetospirillum magneticum AMB-1)
MSDRAWPFLKMHGLGNDFVVLDARARALDLTPERVRAIASRGTGVGCDQLVVMTQATDPC
ADATMLIYNADGSEVAACGNASRCVAWLLMKEIAADKVVFQTKAGLLDAESRGPHQVAVD
MGPARLDWREIPLAEAVDTLHLGISAGPLADPVGVSMGNPHAVFFVDDAEAVNLAQLGRG
LEHHALFPERANIEVAQVLTPPDAEMGRIRMRVWERGAGITMACGTGACATLVAAARRGL
SPRKAEIILDGGTLTIEWLKDGHVLMTGPVAVAFTGTLDSSLLP