Protein Info for AMB_RS01085 in Magnetospirillum magneticum AMB-1

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF02881: SRP54_N" amino acids 46 to 110 (65 residues), 42.9 bits, see alignment E=9e-15 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 58 to 329 (272 residues), 322.6 bits, see alignment E=9.9e-101 PF00448: SRP54" amino acids 129 to 329 (201 residues), 231.6 bits, see alignment E=1.4e-72 PF13604: AAA_30" amino acids 130 to 238 (109 residues), 29.9 bits, see alignment E=8.9e-11

Best Hits

Swiss-Prot: 50% identical to FTSY_RICFE: Signal recognition particle receptor FtsY (ftsY) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to mag:amb0213)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAV8 at UniProt or InterPro

Protein Sequence (332 amino acids)

>AMB_RS01085 signal recognition particle-docking protein FtsY (Magnetospirillum magneticum AMB-1)
MSIFGFGKKKDAAPAPAPEPAAPAAEEPASWFGRLKSGLAKSSSKLTQGLGDLFTKRKLD
DEALEELEDLLITADLGVAMAARVTKHLAKTRFGQDVTSDEIKATLAEEITRILTPVAKP
LEIDSTRKPHVVLVVGVNGSGKTTTIGKMAKTYKDAGLNVTLAAGDTFRAAAVEQLKVWG
ERTHCPVIARETGADAAGLAYDAVEQSRARGDDLLFIDTAGRLQNKADLMAELAKLVRSI
KKVDETAPHDVLLVLDATVGQNAHSQVEIFKDMVAVSGLVLTKLDGTARGGVLVALAEKF
GLPVHAIGIGEKAEDLRPFEADAFAKSLVGME