Protein Info for AMB_RS01060 in Magnetospirillum magneticum AMB-1

Annotation: hydrogenase-4 component E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K12140, hydrogenase-4 component E [EC: 1.-.-.-] (inferred from 100% identity to mag:amb0209)

Predicted SEED Role

"Hydrogenase-4 component E"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAW2 at UniProt or InterPro

Protein Sequence (220 amino acids)

>AMB_RS01060 hydrogenase-4 component E (Magnetospirillum magneticum AMB-1)
MGAQISYDIAHLIGATVLMAGFQLLYQRRLFAVLNTFAFQALALAAAAAWQAHVQHAPHL
YVTAGIALVFKAIIVPIALHWLVEQLGIHKNVETAMSIGWTMMAGVALVTLSILLVLPVT
ANAAALTRESLALAMSVVLLGLLMMITRRNAVTQVVGFMALENGLILAAVSAKGMPLVVE
ISVAFSVLVAMTLFGIFFFRIRERFDTLDLADLETHRGDR