Protein Info for AMB_RS00995 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details PF02635: DsrE" amino acids 25 to 134 (110 residues), 25.7 bits, see alignment E=1.2e-09 PF13686: DrsE_2" amino acids 72 to 147 (76 residues), 32.3 bits, see alignment E=9.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0197)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAX4 at UniProt or InterPro

Protein Sequence (148 amino acids)

>AMB_RS00995 hypothetical protein (Magnetospirillum magneticum AMB-1)
MSAAERHSPDKLSIVVFSGDFDRIHYALVMAAAAIASNTPVTLFFTMWAGRALEKPLPDG
QPAWTRMKCSDGRAAKWVDDSFKAKGVGRFEDLLEACVALGVTFMVCEMGLKALGMDPDG
LRPDVPVAKGGVVTFLADASKTGSMLFI