Protein Info for AMB_RS00970 in Magnetospirillum magneticum AMB-1

Annotation: DUF1924 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details PF09086: DUF1924" amino acids 182 to 275 (94 residues), 129.6 bits, see alignment E=2.3e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0192)

Predicted SEED Role

"Cytochrome B561, bacterial"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAX9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>AMB_RS00970 DUF1924 domain-containing protein (Magnetospirillum magneticum AMB-1)
MNARWEFRLLRLWHAALAGGFLVAYVTADEDTYAMHVFAGYWVVGAIALRLLLALAGSAT
GPLALPRPRLTWAKPGRNPLFAWMAAILAVGMAVAGVTGIAADLIPPLEDLHEGLAEASL
WLVLAHAAIIAWIFQGRRVREMLKGAMPALLAIALLAAPAAFAADAAREAIKAGYAKQAG
AGFAGFSAERGRALFESRNSASPDYASCTTCHTGDPTRYGQHAKTGRAIQPVAVSANPKR
FTDAAKVEERFDRDCQTVLGRACTATEKGDYIAYMESK