Protein Info for AMB_RS00930 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 26 to 30 (5 residues), see Phobius details amino acids 48 to 48 (1 residues), see Phobius details transmembrane" amino acids 31 to 47 (17 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 13 to 312 (300 residues), 64 bits, see alignment E=2.2e-21 PF12698: ABC2_membrane_3" amino acids 29 to 372 (344 residues), 165.2 bits, see alignment E=3.4e-52 PF01061: ABC2_membrane" amino acids 184 to 344 (161 residues), 113.5 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to mag:amb0183)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAY8 at UniProt or InterPro

Protein Sequence (380 amino acids)

>AMB_RS00930 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MNGSASLSWSRLMAVMIKEVIQMRRDRLTFAMMVLVPLLQLVLFGYAINSDPKGLPTLVQ
VQEDGPFARALVAGLRNSSYFRMVGEVRTEAEAERHLATGDAQFVVTVPLGFEAALVRGE
RPALLLEADATDPAAASNAVAAAGALMRTVFDAELTGPLSSLRGRPDPVDLRVHRRYNPE
GISQYNIVPGLMGVILTMTMVMMTALAVTRERERGTMENLLAMPVRPLEVMVGKILPYIG
VGYVQVVVIVASGRWLFGVPLMGSLTLLSVALLLFIASNLTVGFTFSTVAKNQLQAMQMS
FFFFLPSILLSGFMFPFRGMPVWAQWVGEIFPLTHFLRVVRGILLKGNGMAEIWPEMWPI
IAFVLASALLAMKQYRQTLD