Protein Info for AMB_RS00895 in Magnetospirillum magneticum AMB-1

Annotation: benzoyl-CoA 2,3-epoxidase subunit BoxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR03224: benzoyl-CoA oxygenase/reductase, BoxA protein" amino acids 5 to 393 (389 residues), 587 bits, see alignment E=1e-180 PF00037: Fer4" amino acids 9 to 30 (22 residues), 28.3 bits, see alignment (E = 5.8e-10) amino acids 36 to 59 (24 residues), 31 bits, see alignment (E = 7.8e-11) PF13237: Fer4_10" amino acids 9 to 54 (46 residues), 27.9 bits, see alignment 9.3e-10 PF14697: Fer4_21" amino acids 9 to 58 (50 residues), 40.1 bits, see alignment 1.6e-13 PF13187: Fer4_9" amino acids 14 to 58 (45 residues), 33.8 bits, see alignment 1.4e-11 PF12838: Fer4_7" amino acids 14 to 57 (44 residues), 34.1 bits, see alignment 1.6e-11 PF00970: FAD_binding_6" amino acids 153 to 242 (90 residues), 28 bits, see alignment E=1.2e-09 PF00175: NAD_binding_1" amino acids 255 to 360 (106 residues), 51.2 bits, see alignment E=8.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0176)

Predicted SEED Role

"Benzoyl-CoA oxygenase component A" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAZ5 at UniProt or InterPro

Protein Sequence (393 amino acids)

>AMB_RS00895 benzoyl-CoA 2,3-epoxidase subunit BoxA (Magnetospirillum magneticum AMB-1)
MELKRQHLIDPVVCIRCNTCEEACPVDAITHDGTNYVVSYDKCTGCRTCVSPCPTGAIDN
WLLVDQPWSIDDQFGWEELPLGQTGPGPAEPAPLPPGEVSDLLAAATATTGPSVPPPASA
AKPYFNLYSRDTPVTARVAGNMRITGEGTDSDIHHVVLDFSHNAFPFLEGQSIGIVPPGT
DAKGRAHNIRLYSIASPREGERSGCNNLALTVKRVAGGVGSNYVCDLKKGDEVRVAGPFG
QAFLMPDAPNANIIMICTGTGSAPFRAFTERRRRNAQDASGKLMLFFGARTPEELPYFGP
LMKLPKSLIDVNLAFSRVPDRPKQYVQDKIRERSDDLAALLASADTHVFICGLKGMEQGC
DEAFADICRLHGLDWADLRPRMREEGRYHVETY