Protein Info for AMB_RS00885 in Magnetospirillum magneticum AMB-1

Annotation: 2,3-epoxybenzoyl-CoA dihydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03222: benzoyl-CoA-dihydrodiol lyase
  • amino acids 2 to 550 (549 residues), 1021.7 bits, E=0
• PF00378: ECH_1
  • amino acids 42 to 231 (190 residues), 67.9 bits, E=9.1e-23
• PF16113: ECH_2
  • amino acids 44 to 227 (184 residues), 33.1 bits, E=4.5e-12

Best Hits

Swiss-Prot: 55% identical to BOXC_AZOEV: Benzoyl-CoA-dihydrodiol lyase (boxC) from Azoarcus evansii

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mag:amb0174)

MetaCyc: 55% identical to benzoyl-CoA-dihydrodiol lyase monomer (Aromatoleum evansii)
RXN-11054 [EC: 4.1.2.44]

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• adipate degradation (5/5 steps found)
• benzoyl-CoA degradation I (aerobic) (6/7 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• phenylacetate degradation I (aerobic) (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation I (generic) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.1.2.44 or 4.2.1.17

Sequence Analysis Tools

See Q2WAZ7 at UniProt or InterPro

Protein Sequence (550 amino acids)

>AMB_RS00885 2,3-epoxybenzoyl-CoA dihydrolase (Magnetospirillum magneticum AMB-1)
MINFQTSPESYRHWKLAFDGPVATLTMDVDPASTLAPGYELKMNSYDLGVDIELYDAVQR
LRFEHPEVRAVVMASANPKIFCAGANIKMLGVSSHGHKVNFCKFTNETRNSIEDASENSR
QTYLCAVTGTAAGGGYELALATDYIMMVDDGNTAVSLPEVPLLAVLPGTGGLTRVVDKRK
VRRDLADIFCSIEEGVKGKRAVEWRLVDEVIPSSAFKAAVAKKAAELAARSDRPTAEKGV
VLSQVSRVIGTDSVTYPHIDIAFDRATRAANITIKGPKAACPADLAGIKAQGVDFYPLAL
ARELDDAILHLRANETTIATWVFRTQGDADLVMGYDAALQTFGASDWLVREILLYWKRTM
KRLDVTSRTLFALVEPGSCFAGFVAEILFAVDRSFMLDGTFEDNPAPAAAIRLSALNFDG
LPMGNGISRLATRFLGEPDSVGKARDTIGKDLDAAACAKLGLVTGTPDDIDWEDEIRLMI
EERASFSPDSLTGMEANLRFAGPETMETKIFGRLTAWQNWIFQRPNAVGDQGALKLYGTG
KRAAYNQERV