Protein Info for AMB_RS00790 in Magnetospirillum magneticum AMB-1

Annotation: MBOAT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 315 to 343 (29 residues), see Phobius details amino acids 363 to 392 (30 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details PF03062: MBOAT" amino acids 136 to 382 (247 residues), 121.2 bits, see alignment E=6.4e-39 PF13813: MBOAT_2" amino acids 266 to 329 (64 residues), 29 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0155)

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB16 at UniProt or InterPro

Protein Sequence (483 amino acids)

>AMB_RS00790 MBOAT family protein (Magnetospirillum magneticum AMB-1)
MLFNSAPFLFAFLPLVLAGFFGIRRMGWRPAMAFLTLASIVFYAWWNPAYAWPLAASIVG
NFLFGLAIARSRDTRWGGAILALGVAANLAFLGIFKYERFFAESVAPLLGLMITSQRLEL
PLGVSFFTFTQIAYLVDVRRNLVRDADALSYTLFVTFFPHLIAGPIIHHKEMMPQFRQPR
RDCATSENLVAGLSLFAIGLFKKAVIADWVASYVSPGFSAAGAGQDLGLLAAWQCALAYT
VQIYFDFSGYSDMALGLARLFGIDLPVNFNSPYKATSIIEFWRRWHMTLSRFLRDYLYFP
LGGGRCGPVRRHVNLMLVMTLGGLWHGAAWTFVAWGCLHGLMLVGNHAWRAIRPAVPGRG
EVVAGWILTQVLVVVAWVFFRAVNFDAALIVLKGMAGLNGLSGGAVKVAWDGLVLSLVLM
AVCVAAPNSQQIMSATGPGLEPVERPDRLAWRPTTGWAWTLAAMLACSAMTLWRTSEFLY
YQF