Protein Info for AMB_RS00780 in Magnetospirillum magneticum AMB-1

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 1 to 328 (328 residues), 371.7 bits, see alignment E=1.5e-115 PF04055: Radical_SAM" amino acids 14 to 177 (164 residues), 112.3 bits, see alignment E=4.3e-36 PF13353: Fer4_12" amino acids 18 to 107 (90 residues), 26.5 bits, see alignment E=1.1e-09 PF06463: Mob_synth_C" amino acids 183 to 308 (126 residues), 142.2 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 71% identical to MOAA_RHILO: GTP 3',8-cyclase (moaA) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to mag:amb0153)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB18 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AMB_RS00780 GTP 3',8-cyclase MoaA (Magnetospirillum magneticum AMB-1)
MIDPFGRKVSYLRVSVTDRCDLRCVYCMAEDMHFLPKADILSLEELERLCGAFVRSGVRK
LRLTGGEPLVRRNIMSLITNLGRLVKSGELDELTLTTNATQLAKHADGLAAAGVKRLNVS
LDSLDPAKFEAITRWGKLDQVLDGIMAAKAAGLAVKINTVALKGGNEDEHEHLVEWCGRH
GFDLTFIETMPMGDIHSDRTEQYLPLSLVRSRLEQRFTLSEIDYRTGGPARYVRVAETGG
RIGFITPMTHNFCETCNRVRVTCTGTLYMCLGQEDAADLRTPLRASEGDQLLEAAIAEAI
SRKPKGHDFIIDRDSRPAVSRHMSVTGG