Protein Info for AMB_RS00745 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF01029: NusB" amino acids 8 to 130 (123 residues), 85.1 bits, see alignment E=8.6e-28 PF01189: Methyltr_RsmB-F" amino acids 238 to 427 (190 residues), 143.6 bits, see alignment E=9.5e-46

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to mag:amb0147)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB24 at UniProt or InterPro

Protein Sequence (431 amino acids)

>AMB_RS00745 MFS transporter (Magnetospirillum magneticum AMB-1)
MKRASSTSPRAIAVDLLSMVLDKGRLLDDVLDDSRLSRLEDRDRGFVRMLLGTTLRRLGQ
IDTLIEHCLDKPMRAGAAGAEHALRLGICQLLFLDVAPHAAISTTVDLVKGSKLAGFAKL
LNAVLRRLDREGRDLAAAQDAGLLNTPEWLWRSWVKAYGEDGAHAIAAAHLIEAPVDITV
AADSALWAERLEASVLPTGSLRRAAGGSVAALPGFDDGAWWIQDAAAALPARLLGDVRGK
AVADLCAAPGGKALQLAVAGADLTALDRSAKRLVRFTANLKRLGLKAKVVEADAGAWTPP
APFDAILLDAPCSATGTLRRHPDVARHKNPAEVMKLAGVQARLLQAAIPMLKPGGTLVYC
TCSLEAEEGPEQIAALLAGGAPLRRVPIRPEEVGGLAELITPEGDLRTLPCHLASQGGMD
AFFAARLEKVS