Protein Info for AMB_RS00730 in Magnetospirillum magneticum AMB-1

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 7 to 179 (173 residues), 112.9 bits, E=2.2e-36
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 7 to 406 (400 residues), 406.5 bits, E=5.8e-126
• PF00984: UDPG_MGDP_dh
  • amino acids 201 to 289 (89 residues), 82.9 bits, E=2.3e-27
• PF03720: UDPG_MGDP_dh_C
  • amino acids 310 to 409 (100 residues), 71.4 bits, E=1.1e-23

Best Hits

Swiss-Prot: 56% identical to CAPL_STAAU: Protein CapL (capL) from Staphylococcus aureus

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to mag:amb0144)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See Q2WB27 at UniProt or InterPro

Protein Sequence (423 amino acids)

>AMB_RS00730 nucleotide sugar dehydrogenase (Magnetospirillum magneticum AMB-1)
MSTPSSRIAVIGLGYVGLPLAVAIARHFPTIGFDIDQGRVAELHKGLDRTGEVETARLRA
STMRLSAKADDIAGQDVYIVTVPTPVDSGNYPDLKPVLSACRTVGRAMKNGAVVVFESTV
YPGVTEDICGPELEKYSGLKCGTDFFLGYSPERINPGDREHTVDRITKVIAGQTPEVTAL
LARIYGSVTTGGVFPAASIRVAEAAKVIENAQRDINIAFINEITMIFQKLGISVYDVLDA
SSTKWNFLNFKPGLVGGHCIGVDPFYLAQCAQDNGHHPEIILSGRRINDGMGEWIAERVS
AQLSGPSRILVLGLTFKENVPDLRNSKVVDVIRALRARGHSVDVHDPFADPAEAEHEYSE
TLMPSLDGAAGYDCLLGAVPHQPYVAFSGESFTTLVRPDGLVADVKGMWRGMDIPQSLRL
WRL