Protein Info for AMB_RS00705 in Magnetospirillum magneticum AMB-1

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08421: Methyltransf_13
  • amino acids 11 to 72 (62 residues), 76.9 bits, E=2.8e-25
• PF13489: Methyltransf_23
  • amino acids 90 to 246 (157 residues), 56 bits, E=1e-18
• PF08242: Methyltransf_12
  • amino acids 109 to 201 (93 residues), 38.7 bits, E=3.5e-13
• PF08241: Methyltransf_11
  • amino acids 109 to 203 (95 residues), 31.1 bits, E=7.4e-11
• PF08484: Methyltransf_14
  • amino acids 252 to 409 (158 residues), 177.7 bits, E=4e-56

Best Hits

Swiss-Prot: 39% identical to NOVU_STRNV: C-methyltransferase NovU (novU) from Streptomyces niveus

KEGG orthology group: None (inferred from 100% identity to mag:amb0140)

MetaCyc: 43% identical to D-olivose 4-ketoreductase (Streptomyces argillaceus)
2.1.1.-; 1.1.1.-

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

MetaCyc Pathways

• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (5/9 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (5/23 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q2WB31 at UniProt or InterPro

Protein Sequence (414 amino acids)

>AMB_RS00705 class I SAM-dependent methyltransferase (Magnetospirillum magneticum AMB-1)
MSTQHHRRPTCRLCGGKRLTEVVKLVPTPPANAFVPASELDREQERFPLDVFFCEDCAHV
QLLDVVDPRVLFEHYVYVSGTSPVFVRHFEDYAAFVMERFKPVAGGLVLDIGSNDGTLLS
FFQKAGMRVLGIDPAQEISAEATARGIPTICGFFGADKGAEIAAAHGKAEVITANNVFAH
IDDLSGVVDGVRGLLSPSGVFVFEVSYLVDVFENTLFDTIYHEHLDYHSVKPLIRFFAAK
GMELVEAIRVGSHGGSLRGIAQLKGGPHAVGASVAEAVALEERLGLDRAATLAKFAADIE
ALGAELNAVLKSLKAAGKRVGAFGAPAKATTLMYHFGIGPELVDFIIDDSPLKQGLYSPG
MHIPVVSSADGFAKKPDYLVILAWNFAKAIIDKNAAFRSGGGKFIIPIPKVEVV