Protein Info for AMB_RS00640 in Magnetospirillum magneticum AMB-1

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01041: DegT_DnrJ_EryC1" amino acids 14 to 361 (348 residues), 416.2 bits, see alignment E=1.3e-128 PF00155: Aminotran_1_2" amino acids 41 to 212 (172 residues), 28.5 bits, see alignment E=9.4e-11

Best Hits

Swiss-Prot: 51% identical to DESV_STRVZ: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (desV) from Streptomyces venezuelae

KEGG orthology group: None (inferred from 100% identity to mag:amb0127)

MetaCyc: 51% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Streptomyces venezuelae)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB44 at UniProt or InterPro

Protein Sequence (366 amino acids)

>AMB_RS00640 DegT/DnrJ/EryC1/StrS family aminotransferase (Magnetospirillum magneticum AMB-1)
MIPFLDLKAQYRQIKDEVGAAIMKVVDSGAYVGAGPEGKPFEAEFAAYCGVADAAGVNSG
TTALHLALLAAGVKPGDEVITVGATFVATTAAVLYANAKPVFVDVDSATWTMDPAKIEAA
VTPRTKAILPVHLHGLMADMDPIMAIADKHGLKVVEDCAQAHGAEYKGRRAGSIGHVGCF
SFYPGKNLGAYGEGGAIVSNDPEIMKTVRMLRDWGQAKKYDHVLKGFNARLDEIQAAVLR
VKLRYIEGWTEGRRAVAARYEAGLGGLGIGIPKPPAHCRHVYHVYAIRSADRDALQAKLQ
EAGVATGIHYPVPVHLQTAYADLGYKAGDLPVTERIASEWLSLPMFAELEPGQVDAVIAA
VKQAGG