Protein Info for AMB_RS00640 in Magnetospirillum magneticum AMB-1

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 14 to 361 (348 residues), 416.2 bits, E=1.9e-128
• PF00155: Aminotran_1_2
  • amino acids 41 to 212 (172 residues), 28.5 bits, E=1.4e-10

Best Hits

Swiss-Prot: 51% identical to DESV_STRVZ: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (desV) from Streptomyces venezuelae

KEGG orthology group: None (inferred from 100% identity to mag:amb0127)

MetaCyc: 51% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Streptomyces venezuelae)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

• dTDP-D-desosamine biosynthesis (3/6 steps found)
• superpathway of erythromycin biosynthesis (3/19 steps found)
• superpathway of megalomicin A biosynthesis (4/22 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.106

Sequence Analysis Tools

See Q2WB44 at UniProt or InterPro

Protein Sequence (366 amino acids)

>AMB_RS00640 DegT/DnrJ/EryC1/StrS family aminotransferase (Magnetospirillum magneticum AMB-1)
MIPFLDLKAQYRQIKDEVGAAIMKVVDSGAYVGAGPEGKPFEAEFAAYCGVADAAGVNSG
TTALHLALLAAGVKPGDEVITVGATFVATTAAVLYANAKPVFVDVDSATWTMDPAKIEAA
VTPRTKAILPVHLHGLMADMDPIMAIADKHGLKVVEDCAQAHGAEYKGRRAGSIGHVGCF
SFYPGKNLGAYGEGGAIVSNDPEIMKTVRMLRDWGQAKKYDHVLKGFNARLDEIQAAVLR
VKLRYIEGWTEGRRAVAARYEAGLGGLGIGIPKPPAHCRHVYHVYAIRSADRDALQAKLQ
EAGVATGIHYPVPVHLQTAYADLGYKAGDLPVTERIASEWLSLPMFAELEPGQVDAVIAA
VKQAGG