Protein Info for AMB_RS00610 in Magnetospirillum magneticum AMB-1

Annotation: glucose-1-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR02623: glucose-1-phosphate cytidylyltransferase" amino acids 1 to 259 (259 residues), 314.7 bits, see alignment E=2.2e-98 PF00483: NTP_transferase" amino acids 2 to 203 (202 residues), 67.8 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 48% identical to RFBF_SALTY: Glucose-1-phosphate cytidylyltransferase (rfbF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to mag:amb0121)

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB50 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AMB_RS00610 glucose-1-phosphate cytidylyltransferase (Magnetospirillum magneticum AMB-1)
MKVVILCGGFGTRIRDVADDIPKPMIPIGNLPIVWHIMKSYSAAGHKDFVLCLGYKSHAV
KQFFLNYDIHGGDFTIALGAEKQITHHGEVRHDDWSVTLAETGLNAMTGARIRRIRKYLG
DDENFLLTYGDGVSDVDLDALLEFHKSHGKILTVTGVHPPGRFGEIEHANGQVQGFNEKS
QTTSGMISGGYFVCRREIFDYLDDREDLVFEVGPVRALVAAGEMMVYEHHGFWQCMDTYR
DWSLLRDLWDSGKAPWKSWE