Protein Info for AMB_RS00520 in Magnetospirillum magneticum AMB-1

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 18 to 152 (135 residues), 81.8 bits, E=4.8e-27
• PF01380: SIS
  • amino acids 87 to 172 (86 residues), 36.7 bits, E=3.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0103)

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

See Q2WB68 at UniProt or InterPro

Protein Sequence (206 amino acids)

>AMB_RS00520 SIS domain-containing protein (Magnetospirillum magneticum AMB-1)
MSFPDQGFPNIGGFLDAYAEQVNRALATVSRDHLAAAAKLLSEALAADAQLYSCGNGGSA
AISNHLVCDHTKGVCTDTGLKPRVHSLSATVEMLTAIANDIDYAEVFSYQVGLLGRRGDV
LITISSSGNSENVTRAILKAREIGMKSIALTGFEGGRTRDLADVALHVEADNYGVVEDCH
QALMHVLAQYIRMSHMPGDLIAQRRF