Protein Info for AMB_RS00510 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 89 to 105 (17 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 20 to 180 (161 residues), 36.7 bits, see alignment E=1.1e-12 PF20706: GT4-conflict" amino acids 169 to 348 (180 residues), 38.5 bits, see alignment E=1.9e-13 PF00534: Glycos_transf_1" amino acids 190 to 346 (157 residues), 127.7 bits, see alignment E=8.5e-41 PF13692: Glyco_trans_1_4" amino acids 196 to 335 (140 residues), 108.7 bits, see alignment E=7.4e-35 PF13524: Glyco_trans_1_2" amino acids 215 to 351 (137 residues), 37.8 bits, see alignment E=4.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0101)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB70 at UniProt or InterPro

Protein Sequence (373 amino acids)

>AMB_RS00510 glycosyltransferase family 1 protein (Magnetospirillum magneticum AMB-1)
MTRRPDTVRVLINALHAKSGGGVTYLRNILPHLARQEGLELHLLLHADQGETIGELPPGI
HLHAVTFTNGFGRRLLWEQMALPGMARRLGIDVTFSLANYGPLLAPRPVIMLRNALGVFG
QEYRLSKWLYWAGLTAATLASLVGCRAAIAVSDYARRAMGFGIPALFKSKIAVIHHGVDR
RFTPTDQPTERTEGALLAVSDIYVQKNFHTLIRAVARVRQTHPTLRLDIAGRLVDMEYHQ
ELSRLAGDCGVSDCVRFLGSRTPDELVALYRGCDAFVFPSTVETFGNPLVEAMACGTPVI
CSNSAAMPEVAGDAALLIDPLDEAALAAAISRVLDEPELRADLIRRSLARAADFSWEKTG
ALTAAILRRAAGR