Protein Info for AMB_RS00500 in Magnetospirillum magneticum AMB-1

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details PF13727: CoA_binding_3" amino acids 69 to 208 (140 residues), 32.9 bits, see alignment E=1.9e-11 PF04321: RmlD_sub_bind" amino acids 293 to 485 (193 residues), 51.5 bits, see alignment E=2.4e-17 PF02719: Polysacc_synt_2" amino acids 294 to 586 (293 residues), 375.1 bits, see alignment E=6.7e-116 PF01370: Epimerase" amino acids 294 to 506 (213 residues), 72.7 bits, see alignment E=9.6e-24 PF01073: 3Beta_HSD" amino acids 295 to 424 (130 residues), 38.3 bits, see alignment E=2.4e-13 PF16363: GDP_Man_Dehyd" amino acids 295 to 418 (124 residues), 43.9 bits, see alignment E=6.8e-15

Best Hits

KEGG orthology group: K13013, O-antigen biosynthesis protein WbqV (inferred from 100% identity to mag:amb0099)

Predicted SEED Role

"Capsular polysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB72 at UniProt or InterPro

Protein Sequence (633 amino acids)

>AMB_RS00500 polysaccharide biosynthesis protein (Magnetospirillum magneticum AMB-1)
MKLPPLSRAYLAFAHDVSMAALSFVMALYLRLGDDTWIWWDRLDLGLATALFTLVAASVF
LSQRLYRGVWRYASVNDLVALTRAATLTILVFLALLFLTTRLQALPRSVLLINWFVLLAL
LGGPRFIYRTFKDHHRNRRRAQGDHVRVPVLLVGAGDEAELFIRAAHSPDAEYRAVGLLS
SRGARVGRHIHGIDVLGSTDEMGEVVAALKAKGQAPQRLVITDHRLDGSEVRQLLDDADR
LGMTLARIPRMMDLKDGVEERVTMRPIAVEDLLGRPQAVLDRVSMESMIKGRRVLVTGAG
GSIGSELVRQISDFGPASLVLFEACEFNLYAIDQEISLRQPGMELVPLLGDVRDPVRVGE
AMARYRPDLVFHAAALKHVPMVEYNPDEGILTNCVGTRLVADACRANGVSLMVQISTDKA
VNPTNVMGASKRVAEMYAQALDLAESDGGGTRFVTVRFGNVLGSTGSVVPLFQKQLAEGG
PLTVTHPDMTRYFMTVREAVELVLQASAFGIGHPAYRGKIFVLDMGEPVKIVHLARQMIR
LAGLRPDVDVKITFTGLRPGEKLFEELFHGSEPTIQTEMPGILVAEPRAADAAELGAAID
GLEQACRRHDADSALAGLGRLVPEYAAHPPPPN