Protein Info for AMB_RS00495 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 75 to 91 (17 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 266 to 282 (17 residues), see Phobius details amino acids 288 to 304 (17 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 435 to 455 (21 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details amino acids 563 to 583 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0098)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB73 at UniProt or InterPro

Protein Sequence (608 amino acids)

>AMB_RS00495 hypothetical protein (Magnetospirillum magneticum AMB-1)
MLFMAIASFLSDSWAILGRITLQPGPVAASVAAILAITFAGRLLLPRSEPALAFGAGMGG
LILAGTALGVAGLDLRIGLILTAAAAAFALIRDRRELGAWAGIGLPILMVTLPLLLLLSD
RRGSEWDEFSHWLHAFRYVQANHAVPGAPSVPAMATCCAAYPYGWPMVGLAAMTLSGFSE
AVPALLNVLLLALFAMLLAGLAREESAGKLSLPGAAVALLAATAASPTFVHKLAFSAYAD
VPTAFLAAVLALMGERVACDDDRHSRGRWALAFGLVGAALMGVKPGNAALFGCVFGGSGL
LALRREGWKGLFRTHWLIMVLPSAMASGLWRWHVDHYLAGREMTILPMNQWHVAQIPQIL
LAMLDVAGNKSGHFGLGAVMVFLGLRGLVRDRTRLDRLCALAALAFLGYNLFLLVTYVVV
FGDYESQHVASYWRYNTHLGLVIMLPAAMLAGRGLARIGHRAMARSLGWFALVLVLAGPL
LILGQIRFDHDRTKPFLRQSLHTAGAMIPAGEHAVVIDPQGTGVAGVMASYEWSGRVTID
SFLSAFTRGDVRTWLDAQPAHWAFVYSGAAALSLEPVNAAFLLHREGTRWTVIEQFPFPG
GRTPDRWP