Protein Info for AMB_RS00455 in Magnetospirillum magneticum AMB-1

Annotation: KR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00106: adh_short" amino acids 23 to 220 (198 residues), 100.7 bits, see alignment E=1.5e-32 PF01370: Epimerase" amino acids 25 to 238 (214 residues), 32.8 bits, see alignment E=9.9e-12 PF08659: KR" amino acids 26 to 125 (100 residues), 46.5 bits, see alignment E=8.2e-16 PF13561: adh_short_C2" amino acids 34 to 274 (241 residues), 132.8 bits, see alignment E=3.1e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0090)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB81 at UniProt or InterPro

Protein Sequence (275 amino acids)

>AMB_RS00455 KR domain-containing protein (Magnetospirillum magneticum AMB-1)
MFRPLRPEESLRVSEGMSGLDGKVVAVVGGLGLIGRGLVEGIAAAGARVVVASRSAAAPG
ALAVFDHLPEEHRVRIHAVAVDVCDPASVEAMLSAVAGQWSRLDGLVNCAYPQQDAFGTR
FEDVDYTTFRDNVSRHLGAFFLVSQKVLALFAAQGGGNLVQFSSVYGMMNPRFDIYDGTA
MTKEIEYSVAKAGLIHMTSYLAKYFKGKGIRVNCISPGGVFNNQDPAFLARYNAHCNAKG
MMDPADLVGAAVFLLSDASAMVNGQNIVVDDGFSL