Protein Info for AMB_RS00445 in Magnetospirillum magneticum AMB-1

Annotation: acylneuraminate cytidylyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF02348: CTP_transf_3" amino acids 7 to 126 (120 residues), 86.1 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 100% identity to mag:amb0088)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.43

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB83 at UniProt or InterPro

Protein Sequence (234 amino acids)

>AMB_RS00445 acylneuraminate cytidylyltransferase family protein (Magnetospirillum magneticum AMB-1)
MSNRILALICARGGSKGLPGKNVRPLAGRPVIAWSVEAALGSSLIDRVVVSTDDPAIAEV
ARAAGAEVPFLRPAELASDTASLYDVIFHALEALDEEPSHVVLLQATSPLRIAADIDGCI
RLCLDHGAPAAASLCEPGKSPYWMFLLDPDGTVRPVIPHDASGGRRQDLPVAWAPNGAVY
VAETAWLRRERNFWKAGVTLGYVMPLERSVDIDSLLDFRVAEMLMSDRLGPKAG