Protein Info for AMB_RS00370 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00676: E1_dh
  • amino acids 24 to 274 (251 residues), 154.5 bits, E=6.7e-49
• PF13292: DXP_synthase_N
  • amino acids 127 to 191 (65 residues), 29.4 bits, E=1e-10
• PF02779: Transket_pyr
  • amino acids 335 to 501 (167 residues), 92.2 bits, E=6.4e-30
• PF02780: Transketolase_C
  • amino acids 532 to 642 (111 residues), 37 bits, E=5.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0073)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

See Q2WB98 at UniProt or InterPro

Protein Sequence (654 amino acids)

>AMB_RS00370 hypothetical protein (Magnetospirillum magneticum AMB-1)
MQSALPDMAQAEAKKGQDHFATATLIRVVEERLLSLYGEGRLHGTVHTCIGQEWTGVSVA
SALRSGDYILSNHRGHGHYLAWTDDVEGLIAEVMGRESGVCRGRGGSQHLRGQGFFSNGI
IGGMAPVAAGLAMAHRLAGDGGVAVLFIGDGGLGQGALFEALNLAASFSLPLVVLVEANG
IAQSTPVDTVQAGSAVGRARAFGIEARESDTWNPEDLLRAVSATVDTARREGRPLLHLVR
TFRLMPHSKGDDTRAPDLIEEYRLKDPVTQWLAEGGPDAARVRAAAVERVEAAVAKAAAA
PPGLVPSTSPPCYAKPVNLVPVRACEGRLVEHIRAGLDAAMAADDRLLLLGEDICSPYGG
AFKVTSGLSDSYPGRVFNTPISEAGLVGVGAGLALAGRRVVAEIMFGDFLTLVADQLINH
AAKFTQMYGEDVEVPLLVRTPMGGRRGYGPTHSQSLETHFFGVPGLTVLAIHHRMDAAAF
YARLIATAKTPHLIIENKVAYGVDCARDRLQGFSYVETDDDLPTLVVRPCVQAQVTILGY
GGMLLEMEKAMDRLFEDADIVTEAICPVALYPSNMQALLDSVSLTRRLVVVEEGQGYAGY
GAEAVAFLHQHLPGGFSLRRLSALPTAIPCSREGEAACLVSAKDIVEAVQEILS