Protein Info for AMB_RS00170 in Magnetospirillum magneticum AMB-1

Annotation: phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF13580: SIS_2" amino acids 16 to 140 (125 residues), 82 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 100% identical to GMHA_MAGSA: Phosphoheptose isomerase (gmhA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to mag:amb0032)

MetaCyc: 48% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBD9 at UniProt or InterPro

Protein Sequence (192 amino acids)

>AMB_RS00170 phosphoheptose isomerase (Magnetospirillum magneticum AMB-1)
MKFATFLDQQIAEHAETLAVTGAAVREPFQRLVQACVDSLAAGGKILFFGNGGSAADAQH
LAAELVIRYRYNRKALAALALTTDTSTLTACANDFSYEEIFSRQIEALGRPGDVAIGITT
SGSSPNVLTALAVARDMGLVAAGFAGRDGGKMVGLADPLLIVPSNVTARIQEMHILIGHA
LCDQVEAVAAPA