Protein Info for AMB_RS00080 in Magnetospirillum magneticum AMB-1

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 47 to 71 (25 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 47 to 447 (401 residues), 464.2 bits, see alignment E=1.8e-143 PF00909: Ammonium_transp" amino acids 48 to 447 (400 residues), 414.2 bits, see alignment E=2.5e-128

Best Hits

Swiss-Prot: 51% identical to Y663_METTH: Putative ammonium transporter MTH_663 (MTH_663) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to mag:amb0014)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBF7 at UniProt or InterPro

Protein Sequence (449 amino acids)

>AMB_RS00080 ammonium transporter (Magnetospirillum magneticum AMB-1)
MNHRLKSVLLGVGPALGLTLLASMAGAEEAAAPAAAAAPVVLDTGSTAWMLTSTALVLMM
TIPGLALFYAGMVRKKNLLGTMMQSFAITCVVTLLWVIIGYSLAFTGESPFIGGMERFLL
NGLEKASLALPNPVPESVFMMFQMTFAIITPALITGAFADRMKFSSMLVFMSLWLLVVYA
PICHWVWMMDEKGTATGFLGKMGVLDFAGGTVVHINAGVAGLVACLILGPRKGYGTDNMA
PHNLSLSIIGAALLWVGWFGFNAGSAVAADGRAGMAMAVTQVGAAAAAVSWMFAEWLLRK
KPSALGIISGAVAGLVAITPASGFVDVKGALVIGLVAGVVCYWGATGLKHALKYDDSLDA
FGVHGIGGIVGAILTGVFAVEKIGGTAGLLEGNAGQVMTQVYGVLTTLVYTAVVSFILLK
AIDMVMGLRVTAEEEREGLDIALHGETVH