Protein Info for AMB_RS00075 in Magnetospirillum magneticum AMB-1

Annotation: P-II family nitrogen regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00543: P-II
  • amino acids 1 to 107 (107 residues), 161.8 bits, E=3e-52

Best Hits

Swiss-Prot: 72% identical to GLNB_RHIEC: Nitrogen regulatory protein P-II (glnB) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K04752, nitrogen regulatory protein P-II 2 (inferred from 100% identity to mag:amb0013)

MetaCyc: 67% identical to nitrogen regulatory protein PII-2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

See Q2WBF8 at UniProt or InterPro

Protein Sequence (112 amino acids)

>AMB_RS00075 P-II family nitrogen regulator (Magnetospirillum magneticum AMB-1)
MKLIMAIIKPFKLDEVREALTPLGVQGLTVSEVKGFGRQKGQTEIYRGAEYVVNFLPKVK
IEVAVNDDLVDRVVEAIQTAARTGKIGDGKVFVTEIQQAYRIRTGESNAEAL