Protein Info for AMB_RS00065 in Magnetospirillum magneticum AMB-1

Annotation: Cys-tRNA(Pro) deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00011: Cys-tRNA(Pro) deacylase" amino acids 5 to 155 (151 residues), 168.7 bits, see alignment E=3.8e-54 PF04073: tRNA_edit" amino acids 34 to 146 (113 residues), 87.3 bits, see alignment E=4.4e-29

Best Hits

Swiss-Prot: 38% identical to YBAK_SHIFL: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to mag:amb0011)

MetaCyc: 38% identical to Cys-tRNAPro/Cys-tRNACys deacylase YbaK (Escherichia coli K-12 substr. MG1655)
3.1.1.M26 [EC: 3.1.1.M26]

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.M26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBG0 at UniProt or InterPro

Protein Sequence (157 amino acids)

>AMB_RS00065 Cys-tRNA(Pro) deacylase (Magnetospirillum magneticum AMB-1)
MSKTTRATQALDKAGIAYEVCSYAYDPDADKVGMQAAEALGVAPGMVLKTLMVLADGKPA
CVVVPSDREVSMKKLAAALAAKSAQMMKPADAERLTGFVVGGISPFGQKRAVPTLMEEGA
LGQPQVFLNGGQRGLQVKLSPADALKALGAKAAAVVA