Protein Info for AMB_RS00025 in Magnetospirillum magneticum AMB-1

Annotation: chromosome partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 44 to 211 (168 residues), 203.6 bits, see alignment E=1.1e-64 PF02195: ParBc" amino acids 48 to 137 (90 residues), 96.3 bits, see alignment E=9.8e-32 PF17762: HTH_ParB" amino acids 188 to 235 (48 residues), 54.5 bits, see alignment 8.7e-19

Best Hits

Swiss-Prot: 52% identical to PARB_CAUVN: Chromosome-partitioning protein ParB (parB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 60% identity to rru:Rru_A3628)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>AMB_RS00025 chromosome partitioning protein ParB (Magnetospirillum magneticum AMB-1)
MAEEKKKGLGRGLSALLGDHAASAIAAVTSAAAAGPEGQAAIKGLRTMPLEHLQPGKFQP
RRTFDEDRIADLVESVREKGILQPLLVRPLPGNPARFEIIAGERRWRAAQGAKLHEVPVI
VRELSDREALEVALVENLQRQDLSPLEEADGYRRLMDEFSHTQEELAKAVGKSRSHVANM
IRLLALPDPVKGMLEKGELTAGHARALLTAADPLRLARDVVSRALNVRQTEKLVNDEGKA
KPTSGGRPAGGGKDPDIAALERDLTSQLGCRVGIRSLGKGGELTISYGSLEQLDDILARL
SRNPDPSVEDLDAV