Protein Info for AMB_RS00010 in Magnetospirillum magneticum AMB-1

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF01262: AlaDh_PNT_C" amino acids 11 to 53 (43 residues), 23.4 bits, see alignment 1.3e-08 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 18 to 626 (609 residues), 819.7 bits, see alignment E=7.2e-251 PF12831: FAD_oxidored" amino acids 18 to 162 (145 residues), 39.3 bits, see alignment E=1.9e-13 PF01134: GIDA" amino acids 18 to 406 (389 residues), 558 bits, see alignment E=4.4e-171 PF00890: FAD_binding_2" amino acids 18 to 48 (31 residues), 22.4 bits, see alignment (E = 2.4e-08) PF21680: GIDA_C_1st" amino acids 470 to 561 (92 residues), 69.2 bits, see alignment E=1.4e-22 PF13932: GIDA_C" amino acids 566 to 621 (56 residues), 80.8 bits, see alignment 1.8e-26

Best Hits

Swiss-Prot: 100% identical to MNMG_MAGSA: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to mag:amb0002)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBG9 at UniProt or InterPro

Protein Sequence (637 amino acids)

>AMB_RS00010 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG (Magnetospirillum magneticum AMB-1)
MRLTKYGVFHVKQTSSCDVVVIGAGHAGCEAAAAAARFGARTVLLTQRLETIGEMSCNPA
IGGLAKGQLVREIDAMDGLMGRVIDRAGIQFRILNRSKGAAVQGPRAQADRKLYRLAMRA
ALDETENLSLLEGSAEDLVITDGRVAGVVLADGSTIACGAVVITTGTFLRGLIHLGEKTW
PAGRVGDAPSLGLSLALERAGLPLGRLKTGTPARLDGRTIHWDSLDRQEGDDPPVPFSYL
TERITTPQVACGITATTPETHAIIRANLERAPMYSGQIQSTGPRYCPSIEDKVVRFADRE
RHQIFLEPEGLDDHTVYPNGISTSLPEDVQLAMIATIPGLEQCRVIRPGYAIEYDFVDPR
ALHRSLETKGVGGLFLAGQINGTTGYEEAAGQGLMAGLNAARRCAGSAPLVLDRADAYLG
VMIDDLVSLGTSEPYRMFTSRAEYRLLLRADNADSRLTPKGREAGCVDSERWAAFMVKAA
GLERGRALLQSLKGSPDWLRRQGLEINRDGVVRSAWDLLAYPELGLQALAAVWPELDSLS
GAVAEQLEIEGRYAGYLDRQEADIRAYRREEGLALSADLDYDAIGSLSNEVRQKLKAARP
ETLAAAARIPGVTPAAVTALLGHVKKMVLDWAEGPVP