Protein Info for AMB_RS00005 in Magnetospirillum magneticum AMB-1

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF10396: TrmE_N" amino acids 4 to 118 (115 residues), 124.4 bits, see alignment E=5.8e-40 TIGR00450: tRNA modification GTPase TrmE" amino acids 11 to 441 (431 residues), 289.4 bits, see alignment E=5.6e-90 PF12631: MnmE_helical" amino acids 121 to 438 (318 residues), 177.2 bits, see alignment E=1e-55 TIGR00231: small GTP-binding protein domain" amino acids 215 to 360 (146 residues), 64.1 bits, see alignment E=1.3e-21 PF02421: FeoB_N" amino acids 216 to 360 (145 residues), 28.8 bits, see alignment E=1.7e-10 PF01926: MMR_HSR1" amino acids 217 to 327 (111 residues), 75.3 bits, see alignment E=8.2e-25

Best Hits

Swiss-Prot: 100% identical to MNME_MAGSA: tRNA modification GTPase MnmE (mnmE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to mag:amb0001)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBH0 at UniProt or InterPro

Protein Sequence (441 amino acids)

>AMB_RS00005 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Magnetospirillum magneticum AMB-1)
MSETIYALASAAGRAGIAVWRLSGEGSGTALSALTGKPLPEPRRARRVRLRDGAGEVLDD
GLVLWFPAPHSFTGEDVAELHLHGGRAVAAALTARLGELGLRPAEPGEFSRRAFLNGKLD
LTRAEAIADLVDAETAAQRRQALRQLDGGLAGLVEGWRSALVRAMAHLEAVIDFADEDIP
DTLLEQSVGEVRSLRREMEVHLDERRNGERLRDGIHITILGAPNAGKSSLLNRLAGREAA
IVSAQAGTTRDVIEVHLDLGGWPVIVADTAGLRDSACEIESEGVRRAADRAAKADLRLCV
FDGTLYPNLDAATLEMIDDATLVVLNKRDLMTGETPASINGRPVLTLSAKAGEGVDDLVA
ELARVVESRFAMGSAPVLTRERHRVAVAEAVAALSRFDPGLGIEMAAEDLRLAARSLGRI
TGRVDVEEILDVIFHEFCIGK