Protein Info for ABZR88_RS21780 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF06007: PhnJ" amino acids 10 to 278 (269 residues), 424.1 bits, see alignment E=9.8e-132

Best Hits

KEGG orthology group: K06163, PhnJ protein (inferred from 60% identity to dku:Desku_2259)

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABZR88_RS21780 alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIENKKYAQKHNFAFIDEATKKEIRRKLLKAVAIPGYQVPYSSPEMPIARGWGTGGLHVT
LAVIGKDDIFKIIDQGSDASVNACNLREFVHQMTGCQTTYDTAEATLIQTRHRITEEELT
EDQIFIYQVPQPEPLRSVERYEYKTRQMHGEADYAKMWVSLYEQIVRHGDIMLGAGYPVK
VNHRYVMAPSPIPRWDVPNLNNSKALHLFGAGREKRLYAVPPYTVVEPLEFDDIKFHTES
FAGTECYRTNYKKAFLDELYFDDGSKHYIINDSNFLDKLDAGQEPKQHENIYINQIEA