Protein Info for ABZR88_RS21430 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00106: adh_short" amino acids 92 to 279 (188 residues), 147.7 bits, see alignment E=4.5e-47 PF08659: KR" amino acids 94 to 241 (148 residues), 26.9 bits, see alignment E=6.3e-10 PF13561: adh_short_C2" amino acids 99 to 332 (234 residues), 170.7 bits, see alignment E=6.2e-54

Best Hits

Swiss-Prot: 57% identical to YGHA_ECO57: Uncharacterized oxidoreductase YghA (yghA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 74% identity to sli:Slin_4034)

MetaCyc: 57% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>ABZR88_RS21430 SDR family oxidoreductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQNESKMNRRQAVAGIGTALAAVAVTPVLGGTPMENKPYDGPARISDPTKLHPKPPFKSQ
PQPWPGLQSKMDPVPDCGERSYKGSGRLTGRKALITGGDSGMGRAAAIAYAREGADVAIN
YYPTEEPDAQEVIALIKKEGRKAIAIPGDLRQEAFCKELVHKAIAGLGGLDIIVNNAGRQ
QSQNSILDITSEAFDATMKTNIYAPFWIIREALPHLPPGSAIIGTTSEQAYDPSPDLYDY
AQTKAATMNYVKSLAKQLGPKGIRVNGVAPGPIWTALQISGGAQPEKQQMFGSWTMLGRP
GQPAELASIYVQLAAADASFASGQVYGSSGGVGQP