Protein Info for ABZR88_RS21040 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 68 to 86 (19 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 179 (157 residues), 88.8 bits, see alignment E=3e-29 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 23 to 178 (156 residues), 148.6 bits, see alignment E=1.9e-47 PF04542: Sigma70_r2" amino acids 27 to 92 (66 residues), 36.9 bits, see alignment E=5.2e-13 PF08281: Sigma70_r4_2" amino acids 127 to 177 (51 residues), 50.4 bits, see alignment E=2.8e-17 PF04545: Sigma70_r4" amino acids 131 to 178 (48 residues), 27.9 bits, see alignment E=2.6e-10 PF00196: GerE" amino acids 150 to 178 (29 residues), 31.3 bits, see alignment 2.4e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 50% identity to shg:Sph21_2954)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>ABZR88_RS21040 RNA polymerase sigma-70 factor (Mucilaginibacter yixingensis YX-36 DSM 26809)
MTDYTTLSENILVDLLRDDKLGAFKELYKRHWKKLYNAAWKRLRNKELCEEIVQELFTNL
WVKRHSLPLINGVSSYLYSSVIHLVIDHYRKELVREKYREAFIAVHGHETDNSTEETILL
KDLTDTIEQEISQLPDKCRSVYELSRKQHKTNKEIALYLGISEKTVENHLTKALKRLQLG
LSHYLGFLVFLLIK