Protein Info for ABZR88_RS20925 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 14 to 344 (331 residues), 312 bits, E=2e-97
• PF00586: AIRS
  • amino acids 38 to 150 (113 residues), 96.6 bits, E=1.3e-31

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 73% identity to psn:Pedsa_3018)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (347 amino acids)

>ABZR88_RS20925 thiamine-phosphate kinase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MFDNKETTGLENLGEFGLIGHLTKNIKLKHPGSLKGVGDDAAVLDFAGKKVLLSTDMLLE
GIHFDLSYTPLKHLGYKAIQVNLSDICAMNGTPTQVTVSIGVSSKFPLEAIEELYDGIYI
ACEKYNVDLVGGDTTSSRQGLVISVSVLGYADEQDIAYRNTAQEGDLLCVSGDLGGAYVG
LQLLEREKMIYLENPKIQPDLEGKDYIIERQLKPESRKDIVELLRAIGVKPTSMIDVSDG
LASEILHICNQSNKGCNLYEEKIPIDPMTYDTAREFNLDPTICALSGGEDYELLFTVKQS
DYDKLKNQPDISIIGHITEASAGRNLVSRTGNVHELKAQGWNAFKGE