Protein Info for ABZR88_RS20730 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: flavodoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00175: NAD_binding_1
  • amino acids 106 to 205 (100 residues), 74.4 bits, E=1.7e-24

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 61% identity to gfo:GFO_3490)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (222 amino acids)

>ABZR88_RS20730 flavodoxin reductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MEHIVRILDIAQVTHNVKAFRVEKPDDYVFEPGQATEVSINQQGWEDEKRPFTFTSLNDQ
HYLEFTIKGYFDHDGVTNKLHSLVTGDELIVRDIWGAIAYKGEGTFIAGGAGITPFISIL
RQLHKDGRLQGNQLFFANQTEDDIIYKDELDQMLGNNVQYLLSRAQGSGKYPVGRIDADY
LKTHIKDFSQHFYVCGPDEMVKDISDLLTDLGAQPDAVVFEK