Protein Info for ABZR88_RS20445 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: Rne/Rng family ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00757: ribonuclease, Rne/Rng family
  • amino acids 16 to 437 (422 residues), 445.4 bits, E=1e-137
• PF10150: RNase_E_G
  • amino acids 143 to 413 (271 residues), 334.7 bits, E=2.2e-104

Best Hits

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 80% identity to phe:Phep_0126)

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ether lipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.- or 3.1.4.-

Protein Sequence (516 amino acids)

>ABZR88_RS20445 Rne/Rng family ribonuclease (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIKELIIDSTPNGSTIALLQDKQLVELHKEHINNNYTVGDIYLGRIKKIMPGLNAAFVDV
GYEKDAFLHYLDLGPQVQSLLKLTKQVKSGGYTAKLLDNFKLEADINKAGKISEVLTKGQ
LIPVQIAKEPISTKGPRLSSDLSIAGRYVVLVPFSETISISKKIKSNTERTRLRKIIESI
KPKNFGVIIRTVSENKGVAEMQKDLLDLVSKWESFITRLPGTEPSKKVLGEIDRTSTILR
DILNPDFQHIYVNETSIYEEIKSYVHEISPEMENIVRLHKHKDPIFEHYGIEKQIKGAFG
KTVNLAGGAYLVIEHTEALHVIDVNSGNRTANKENQEENAFQVNKEAAKEIARQLRLRDM
GGIVVIDFIDMHKPTNRKELFDFLRQEMSHDRAKHTILPPSKFGLVQITRQRVRPEMNIV
TSEVCPTCHGTGTVRPTILLLDDIENNFNYILVEQNEKHITLCVHPYIEAYIKKGIMSRQ
RKWYFKYGQWIKVKSNSSYQITEFHFFSNKDEEIKL