Protein Info for ABZR88_RS19915 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/3-hydroxyacyl-ACP dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  • amino acids 3 to 227 (225 residues), 201.4 bits, E=1e-63
• PF03331: LpxC
  • amino acids 5 to 299 (295 residues), 294.7 bits, E=7.4e-92
• PF07977: FabA
  • amino acids 331 to 455 (125 residues), 95.7 bits, E=2e-31

Best Hits

Swiss-Prot: 48% identical to LPXZ_PORGI: Bifunctional enzyme LpxC/FabZ (lpxC/fabZ) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 79% identity to shg:Sph21_1541)

MetaCyc: 48% identical to bifunctional UDP-3-O-acyl-N-acetylglucosamine deacetylase/3-hydroxyacyl-[acyl-carrier-protein] dehydratase (Porphyromonas gingivalis W50)
3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 4.2.1.59]; RXN-22242 [EC: 4.2.1.59, 3.5.1.108]; 3.5.1.108 [EC: 4.2.1.59, 3.5.1.108]

Predicted SEED Role

"N-acetylglucosamine deacetylase (EC 3.5.1.-) / 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 3.5.1.-, EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (39/43 steps found)
• palmitate biosynthesis III (28/29 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)
• mycolate biosynthesis (18/205 steps found)
• superpathway of mycolate biosynthesis (19/239 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid biosynthesis
• Glutathione metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Sphingolipid metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-, 4.2.1.-, 4.2.1.59

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108 or 4.2.1.- or 4.2.1.59

Protein Sequence (464 amino acids)

>ABZR88_RS19915 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/3-hydroxyacyl-ACP dehydratase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNVKQRTIKSPVSVSGTGLHTGASATMTFNPAPENHGYKFRRVDVAGSPVIDADCDNVTD
TSRGTTITQNGASVSTVEHVLAALVGLEIDNVLIDIDGPETPIMDGSSIFFVDALTEVGT
VEQDADREYYHIPYNIHYSEGDRKVEMVAMPLDDYRFTCMVDYNSPVLGSQHASISSISE
FRKEIASCRTFCFLHELEMLLKHDLIKGGDLNNAIVVVDKDVNNEELQHLAKLFNREEIK
VAPQGILNNIELRHQNEPARHKLLDMIGDLALVGVPLKGHIMAARPGHAANVAFAKKIKA
LIKKERSRKHVKVYDPNMKPVYDTVQIMNILPHRPPMLLVDKILELTKTHVVGLKSVTMN
EPFFAGHFPGAPVMPGVLQIEAMAQTGGILVLNTVPDPENYLTLFLKIENARFKDKVLPG
DTLIFRCDLIGPIRRGIAQMKGIGMVGERVVVEAELMAQIVRYK