Protein Info for ABZR88_RS18635 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 26 to 561 (536 residues), 532.1 bits, see alignment E=6.4e-164 PF01368: DHH" amino acids 80 to 228 (149 residues), 92.8 bits, see alignment E=3.2e-30 PF02272: DHHA1" amino acids 323 to 441 (119 residues), 71.5 bits, see alignment E=1.6e-23 PF17768: RecJ_OB" amino acids 456 to 561 (106 residues), 100.6 bits, see alignment E=8e-33

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 64% identity to psn:Pedsa_2367)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>ABZR88_RS18635 single-stranded-DNA-specific exonuclease RecJ (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQKRWTIKETNDKATVANLAAALSIEPTLADILVQRGVNTFDEARYFFRPVLEHLHDPFL
MRDMELAIARIDQAIARQERILIYGDYDVDGTTAVALVYSFFSKRYNHLEYYIPDRYLEG
YGISTKGIDYAAANGFSLIIALDCGIKSVDKIAYANTLGVDFIICDHHLAGEEIPAAAAV
LDPKRPGCEYPYKELSGCGIGFKLIQAYAQAHDIPFEEVTEYLDLVAISVACDIVHINGE
NRVLAYYGLQKINNNPCVGVRALMGVAGRSGAYTITDVVFQLGPRINAAGRIDDAKHAVE
LLIACHDDDAQTMGTLINLKNLERKEHDTNITGDALSMIDNDAILINRKSTVVFNEGWHK
GVIGIVASRLTEKYYRPTVVLTRSNGHVAGSARSVRGYDLYEALCGCADLLIQFGGHKYA
AGLTLEPENIEAFTERFEQIVSSTIAPELLIPEILIDAEVDFKQIDAKFFRILQQLAPFG
PENMSPTLLTRNVKVRGAASLVGQHHLKMVLEQPDAPVFEAIAFGQGEMLDQVNSGQLFD
VCYHIEENVWRDKRTVQLNIKGIRFSE