Protein Info for ABZR88_RS18470 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: DUF5684 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 60 (16 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details PF18936: DUF5684" amino acids 47 to 125 (79 residues), 98.5 bits, see alignment E=1.4e-32

Best Hits

KEGG orthology group: None (inferred from 47% identity to shg:Sph21_0705)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>ABZR88_RS18470 DUF5684 domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
METYDSSAGTAVAAGAIVMFIVIMLLWVLIPIVGMWKAFSKAGKPGWAAIIPIYNYIVML
EITGKPLWWCILMLFPCTSLIFVVWNTNLISKSFGKSEGFTVGLFFLPFIFWPILGFGDA
QYLGPSAKEAMAANRFGSADYQRPFDNNAQ