Protein Info for ABZR88_RS18415 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: phosphoribosylformylglycinamidine synthase subunit PurQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 226 (226 residues), 315.6 bits, E=7.8e-99
• PF13507: GATase_5
  • amino acids 4 to 212 (209 residues), 156.8 bits, E=5.8e-50
• PF07685: GATase_3
  • amino acids 25 to 94 (70 residues), 34.2 bits, E=2e-12

Best Hits

Swiss-Prot: 59% identical to PURQ_CARHZ: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 69% identity to fte:Fluta_1839)

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (230 amino acids)

>ABZR88_RS18415 phosphoribosylformylglycinamidine synthase subunit PurQ (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKFGVVTFPGSNCDEDLIHVLEKIMGQQVVRLWHKEHNLQGADFILLPGGFSYGDYLRSG
AIARFSPIMQEVIQFAGKGGKVMGICNGFQILTEAGLLPGALLHNNNRKFICRNTYLKVQ
TQNSLVTAGIDPQAALKIPIAHGEGNYFADADVLKALNDNDQVLFRYCDESGNITPDANP
NGSLENIAGVCSKERNVFGMMPHPERAADSLLSNQDGLAIFESILSIANA