Protein Info for ABZR88_RS18375 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 2 to 359 (358 residues), 597.9 bits, E=2.9e-184
• PF04321: RmlD_sub_bind
  • amino acids 3 to 174 (172 residues), 29.2 bits, E=1e-10
• PF01370: Epimerase
  • amino acids 4 to 251 (248 residues), 259.9 bits, E=4.2e-81
• PF16363: GDP_Man_Dehyd
  • amino acids 5 to 352 (348 residues), 503.2 bits, E=8.4e-155
• PF02719: Polysacc_synt_2
  • amino acids 5 to 117 (113 residues), 22.3 bits, E=1.4e-08

Best Hits

Swiss-Prot: 62% identical to GM4D_VIBCL: GDP-mannose 4,6-dehydratase (gmd) from Vibrio cholerae

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 84% identity to psn:Pedsa_3226)

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-perosamine biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Protein Sequence (378 amino acids)

>ABZR88_RS18375 GDP-mannose 4,6-dehydratase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKKALITGITGQDGAYLAEFLLKKGYEVHGLKRRSSLFNTDRIDHLYHDLHDEDVKFKLH
FGDMTDSTNLIRLIQEVQPDEIYNLAAQSHVKVSFDTPEYTANADGIGTLRVLEAVRLLG
LTEKTRIYQASTSELYGLVQAVPQSETTPFYPRSPYAVAKLYGYWIVVNYREAYNMYTCN
GILFNHESPIRGETFVTRKITRAAAKIALGLQNCMYMGNLSAQRDWGHAKDYVEAMWLML
QQDKPEDYVIATGVTTTVREFIRLTFAELGIEVEFSGKNEEERGVIVDVDRERAQSLGLD
PDSLKFGQTVVKIDPQYFRPTEVELLIGDATKAREQMGWKPRYDLKALITDMVTADLHLV
KKDDYLQKGGFKTLNYFE